PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC027036.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 404aa    MW: 45612.8 Da    PI: 6.8935
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC027036.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.4e-3178131255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   prlrWtpeLH rF +ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  EcC027036.30  78 PRLRWTPELHLRFTQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 131
                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-2874132IPR009057Homeodomain-like
PROSITE profilePS5129411.77474134IPR017930Myb domain
SuperFamilySSF466899.32E-1577132IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2278133IPR006447Myb domain, plants
PfamPF002491.5E-979130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MNGDQNDGGL NKMVAIPLEI RSEDEEEGDC ESKTRNSTSS SNSIVEEFIE NNNNSDKKNG  60
ISSGTSTGLR PYVRTQVPRL RWTPELHLRF TQAVERLGGQ ERATPKLVLQ LMNIKGLSIA  120
HVKSHLQMYR SKKINDRGEV INSRQDFMGS ADQLPHAFWR HSILQNLDRK ISNIRDFRWS  180
SDRNWMSGPY LTDVAMGNAR NGIRITGFMG DNMNHVSHHS HPNTKDNFYF ELGRRKQPQD  240
PVLDSSNFSL LSGLTHSHPQ QKSTQIQPSK DQLIHEMRKA PQDEIWRIDI DGDHRERSTV  300
KRKADHGDGG GDLDLNLSLS NKMPRLVEVR RNDSGEQNEG EVVDGNLCLS LSCPSSSSSS  360
SLDLSLDLNM PFDKLKSLKE SDDSANVTYP KYLNLVSTLD LTMN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032996.10.0PREDICTED: uncharacterized protein LOC104422379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein